PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G286400.1.p
Common NamePRUPE_ppa000876mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 1010aa    MW: 113385 Da    PI: 7.8064
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G286400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix26.61.5e-082423002281
            trihelix  22 rrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                          r+k ++ + +ev+++++++g++r +k+   kw+n+ ++++k+ e+e++ + e++   +y
  Prupe.2G286400.1.p 242 TRSKTRADKDREVAEFLQKHGVNRDAKTAGTKWDNMLGEFRKVYEWERGAEREQV-GKSY 300
                         56788889999*************************************9755444.3445 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561123.71E-15826990IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.107.7E-7855994No hitNo description
CDDcd001802.03E-12861990No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 1010 aa     Download sequence    Send to blast
MGDNKGDTSK KQPQQQQTQQ QQQISPSPND PLEDQLLPTE ITRPRHHQPQ PPPAAAPFNI  60
PAPLFVPSGA ATSSSSPFDQ QHFEAAVNPK RPRYTTGQWK LLPSPSSQTK QTQIPILAKE  120
STPSPNPKST QLPQPHVTPT GAASSSDTAS SPPAHSPLPS LSATSGQDTN KTEGDLQNPV  180
HNHQFRKGKY VSPVWKPNEM LWLARGWRIQ YQGGPAGGSS DHGSGSSSRT EQIPTETGTP  240
HTRSKTRADK DREVAEFLQK HGVNRDAKTA GTKWDNMLGE FRKVYEWERG AEREQVGKSY  300
FRLSPYERKL HRLPASFDEE VFEELSQFMG SRMRTPQSRL GSVGDDSRSA FVVTRSLTQP  360
PSFKEDEFPP SGSKKQLMIM SGGGEPFYHG GRGTLLGFHH HDQSSLDFTA GLSSSSASKE  420
LRRIGKIRMT WEELVSLWAE EGEHHRGRVR LQGSSFLNAD ELTFFDDSMV ACTMEAFEDG  480
PLRGFSVDRF VSGQVVKVFG RRKPSSSTSG FNEKVQLSLP ESASRSIPST EFQDPTEYYV  540
GCLGAPPPSL PSLPELQWYL QEPPPEELRF PLRKDVYRDL PQGKEIFFTT STELLDCRAI  600
TYDILSPIIR TNPSLSASTA TSRDSFIPIW DDCINRLVSK FCSLEMVFIR RPNASSPTEP  660
LQDQWPNVTG FVRSFCLWRG EETDQLRDSH DMNPSSSIVE KILWTYMDLP YIFGYYAIGY  720
VVTFCALSRS QDRINRTDLA TIDLSSPSER LKALLPCYRI AGLLPLLADR CFNNTNCNKL  780
LPHSDFERLD LGNGRNIVEM TPTTVTRFFS NVRKWTAVKE IYDFLDHRIP HAEYIHRSLE  840
RDLGLVFKPR GCKCKPTNCE QLVEALKYVT KALVALHDLS FMHRDISWEK VMRRTERENE  900
WFVCGFEEAV GAPQIYPRRA VAAGESAARV RHAPEMERGL HGVKVDVWGV GYLVRNCGLT  960
GVPKMLRELQ NRCLDQNPEQ RPTAADCYHH LLQLQSSLQS ATAGCVLGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234479.10.0PREDICTED: uncharacterized protein LOC103333428
TrEMBLM5XR370.0M5XR37_PRUPE; Uncharacterized protein
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.15e-08Trihelix family protein